PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009107944.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 630aa    MW: 70287.6 Da    PI: 6.4752
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009107944.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.96.5e-2956140187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+++e+laL+++r+em++++r++ lk+plWe+vs+k+ e g++r++k+Ckek+en++k++k++ke++++r++++  t+++f+qlea
  XP_009107944.1  56 RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRNAKKCKEKFENVQKYHKRTKETRGGRHEGK--TYKFFSQLEA 140
                     8********************************************************************985555..6*******85 PP

2trihelix104.29.6e-33404488186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW+k+e+laLi++r+ me r++++  k+ lWee+s+ m++ g++r++k+Ckekwen+nk+ykk+ke++kkr +++ +tcpy+++l+
  XP_009107944.1 404 RWPKEEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKKR-PQDAKTCPYYHRLD 488
                     8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.93449113IPR017877Myb-like domain
SMARTSM007170.01753115IPR001005SANT/Myb domain
CDDcd122034.82E-2555120No hitNo description
PfamPF138373.7E-1955141No hitNo description
SMARTSM007174.3E-4401463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-4403460IPR009057Homeodomain-like
PfamPF138376.2E-22403488No hitNo description
PROSITE profilePS500907.189403461IPR017877Myb-like domain
CDDcd122031.04E-29404468No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MEQGGGGGGG NEVVEEASPI SSRPPANMEE LMRFSAAADD GGGLGGGSSS SSSGNRWPRE  60
ETLALLRIRS EMDSTFRDAT LKAPLWEHVS RKLLELGYKR NAKKCKEKFE NVQKYHKRTK  120
ETRGGRHEGK TYKFFSQLEA LNTITSAPPS SLDVTPLSVA NPVQQPSSQF PVFSLTQTPP  180
PSQPLPPHTV SFTPNPPPPP SVDPPFPGGT FSSHSSSTAS GMGSDDDDDD MDVDHAGPSS  240
HKRKRENRGG KMMELFQGLV RQVMQKQAAM QRSFLEALEK REQERLAREE AWKRQEMSRL  300
AREHEIMTQE RAASASRDAA IISLIQKITG HTIQLPPSLS SQPSPPPPAA KRPSSQAVEP  360
PHSQPIMAIP QQQVLPPPPH QPPPQQQQQE MIMSSDQSLP SSSRWPKEEI LALINLRSGM  420
EPRYQDNVPK GLLWEEISSS MKRMGYNRNA KRCKEKWENI NKYYKKVKES NKKRPQDAKT  480
CPYYHRLDLL YRSKVLGSGA GSSTSALPQD QISTVQKQSP VPAMKPSQEG DVNVHQGEEP  540
REETPQGAEK PEDLVMRELM QQKQQQQEED SMIGEYEKIE ASHKYNMEEE EMDEELDEDE  600
KSAAYEIAFQ SPANRGGNGH SEPPFLTMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198106KRNAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210451e-140AC021045.2 Arabidopsis thaliana chromosome I BAC T9L6 genomic sequence, complete sequence.
GenBankAC0270351e-140AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankAJ0032151e-140AJ003215.1 Arabidopsis thaliana GTL1 gene.
GenBankAY1400851e-140AY140085.1 Arabidopsis thaliana DNA-binding factor, putative (At1g33240) mRNA, complete cds.
GenBankBT0088241e-140BT008824.1 Arabidopsis thaliana At1g33240 mRNA, complete cds.
GenBankCP0026841e-140CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009107944.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ9C8820.0GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLM4F6M10.0M4F6M1_BRARP; Uncharacterized protein
STRINGBra036731.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.11e-133GT-2-like 1